Name :
FLJ46380 (Human) Recombinant Protein (P01)
Biological Activity :
Human FLJ46380 full-length ORF ( ENSP00000344316, 1 a.a. – 244 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Best use within three months from the date of receipt of this protein.
Protein Accession No. :
ENSP00000344316
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=388591
Amino Acid Sequence :
MSGAIFGPLEGPSSLDAPSIHPLVCPLCHVQYERPCLLDCFHDFCAGCLRGRATDGRLTCPLCQHQTVLKGPSGLPPVDRLLQFLVDSSGDGVEAVRCANCDLECSEQAGAAGRVGEEQRVPGCTVPNACTCTQHVFRGRPGSGFSSTSLGHLGPKCEPHYTGGETEVQNKGLEPVSRQWQRLRPFDLGRAHWSPIQGGVVDLHRRGSPVCRPGPTLKGLCYPSGIEAATAQGRWGQHAVPSGL
Molecular Weight :
52.4
Storage and Stability :
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Host :
Wheat Germ (in vitro)
Interspecies Antigen Sequence :
Mouse (68); Rat (63)
Preparation Method :
in vitro wheat germ expression system
Purification :
Glutathione Sepharose 4 Fast Flow
Quality Control Testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Applications :
Enzyme-linked Immunoabsorbent Assay， Western Blot (Recombinant protein)， Antibody Production， Protein Array，
Gene Name :
RNF207
Gene Alias :
C1orf188, FLJ32096, FLJ46380, FLJ46593
Gene Description :
ring finger protein 207
Gene Summary :
Other Designations :
OTTHUMP00000001377
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Integrin Associated Protein/CD47 Recombinant Proteins
CD7 medchemexpress
Popular categories:
Ubiquitin Conjugating Enzyme E2 L6
CTLA-4
