Name :
ATOX1 (Human) Recombinant Protein
Biological Activity :
Human ATOX1 (NP_004036.1) full-length recombinant protein expressed in yeast.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength
Tag :
Protein Accession No. :
NP_004036.1
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=475
Amino Acid Sequence :
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Molecular Weight :
7.39
Storage and Stability :
Store at -20°C. Aliquot to avoid repeated freezing and thawing.
Host :
Yeast
Interspecies Antigen Sequence :
Preparation Method :
Yeast expression system
Purification :
Affinity Purification
Quality Control Testing :
Storage Buffer :
In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol)
Applications :
SDS-PAGE，
Gene Name :
ATOX1
Gene Alias :
ATX1, HAH1, MGC138453, MGC138455
Gene Description :
ATX1 antioxidant protein 1 homolog (yeast)
Gene Summary :
This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. [provided by RefSeq
Other Designations :
antioxidant protein 1|copper transport protein|metal transport protein
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-3 Proteinmedchemexpress
IL-22 Recombinant Proteins
Popular categories:
PTPRF
Biliary Glycoprotein/CD66a
