Name :
p24 (HIV1) Recombinant Protein
Biological Activity :
p24 (HIV1) (AAA44987, 155 a.a. – 321 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Tag :
Protein Accession No. :
Protein Accession No.URL :
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETL
Molecular Weight :
21.2
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Conventional Chromatography
Quality Control Testing :
15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer :
In 20 mM Tris-HCl buffer, 100 mM NaCl, pH 8.0 (0.1 mM PMSF, 10% glycerol).
Applications :
SDS-PAGE,
Gene Name :
Gene Alias :
Gene Description :
Gene Summary :
Other Designations :
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD14 ProteinBiological Activity
FGF-16 ProteinGene ID
Popular categories:
PLGF
Cyclin-Dependent Kinase 5 (CDK5)
